MGC39633 Antibody - N-terminal region (ARP44931_T100)

• Product Number: ARP44931_T100
• Name: MGC39633 Antibody - N-terminal region (ARP44931_T100)
• Protein Size (# AA): 529 amino acids
• Molecular Weight: 62kDa
• NCBI Gene Id: 153733
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Coiled-coil domain containing 112
• Alias Symbols: MBC1
• Peptide Sequence: Synthetic peptide located within the following region: VRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELENKLIHSRKTE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Brandenberger,R., (2004) Nat. Biotechnol. 22 (6), 707-716
• Description of Target: The function remains unknown.
• Protein Interactions: KRT40; FSD2; TNIP1; KRT31; LURAP1; CCDC85B; TEX9;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CCDC112 (ARP44931_T100) antibody is Catalog # AAP44931 (Previous Catalog # AAPP26012)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MGC39633
• Uniprot ID: Q6A334
• Protein Name: Coiled-coil domain-containing protein 112
• Protein Accession #: NP_001035530
• Purification: Protein A purified
• Nucleotide Accession #: NM_001040440
• Tested Species Reactivity: Human
• Gene Symbol: CCDC112
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 93%
• Image 1: Human Jurkat
  
  WB Suggested Anti-MGC39633 Antibody Titration: 1.25ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Human kidney
  
  Human kidney