| Product Number |
ARP44910_T100 |
| Product Page |
www.avivasysbio.com/mospd3-antibody-c-terminal-region-arp44910-t100.html |
| Name |
MOSPD3 Antibody - C-terminal region (ARP44910_T100) |
| Protein Size (# AA) |
225 amino acids |
| Molecular Weight |
26 kDa |
| NCBI Gene Id |
64598 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Motile sperm domain containing 3 |
| Alias Symbols |
CDS3, NET30 |
| Peptide Sequence |
Synthetic peptide located within the following region: FLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Pall,G.S., (2004) Genomics 84 (6), 1051-1059 |
| Description of Target |
MOSPD3 is a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality.This gene encodes a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality. Alternate transcriptional splice variants, encoding different isoforms, have been described. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-MOSPD3 (ARP44910_T100) antibody |
| Blocking Peptide |
For anti-MOSPD3 (ARP44910_T100) antibody is Catalog # AAP44910 (Previous Catalog # AAPP25988) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human MOSPD3 |
| Uniprot ID |
O75425 |
| Protein Name |
Motile sperm domain-containing protein 3 |
| Sample Type Confirmation |
MOSPD3 is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_001035188 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001040099 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MOSPD3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Goat: 77%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100% |
| Image 1 | Human Muscle
 | Human Muscle |
|
| Image 2 |
 | 25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. |
|
