CHIC1 antibody - N-terminal region (ARP44893_T100)
Data Sheet
Product Number ARP44893_T100
Product Page
Product Name CHIC1 antibody - N-terminal region (ARP44893_T100)
Gene Symbol CHIC1
Protein Size (# AA) 217 amino acids
Molecular Weight 24kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Official Gene Full Name Cysteine-rich hydrophobic domain 1
Alias Symbols RP11-108A15.1, BRX, DKFZp313P1931, DKFZp686F2342
NCBI Gene Id 53344
Host Rabbit
Clonality Polyclonal
Size 100 ul
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Description This is a rabbit polyclonal antibody against CHIC1. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: LRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRV
Target Reference Cools,J., (2001) FEBS Lett. 492 (3), 204-209
Description of Target The function remains unknown.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-CHIC1 (ARP44893_T100) antibody is Catalog # AAP44893 (Previous Catalog # AAPP25971)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CHIC1
Complete computational species homology data Anti-CHIC1 (ARP44893_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CHIC1.
Swissprot Id Q5JSZ4
Protein Accession # NP_001034929
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CHIC1.
Nucleotide Accession # NM_001039840
Replacement Item This antibody may replace item sc-515175 from Santa Cruz Biotechnology.
Conjugation Options

ARP44893_T100-FITC Conjugated

ARP44893_T100-HRP Conjugated

ARP44893_T100-Biotin Conjugated

CB Replacement sc-515175
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-CHIC1 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |