| Product Number |
ARP44893_T100 |
| Product Page |
www.avivasysbio.com/chic1-antibody-n-terminal-region-arp44893-t100.html |
| Name |
CHIC1 Antibody - N-terminal region (ARP44893_T100) |
| Protein Size (# AA) |
217 amino acids |
| Molecular Weight |
24kDa |
| NCBI Gene Id |
53344 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Cysteine-rich hydrophobic domain 1 |
| Alias Symbols |
BRX |
| Peptide Sequence |
Synthetic peptide located within the following region: LRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Cools,J., (2001) FEBS Lett. 492 (3), 204-209 |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CHIC1 (ARP44893_T100) antibody |
| Blocking Peptide |
For anti-CHIC1 (ARP44893_T100) antibody is Catalog # AAP44893 (Previous Catalog # AAPP25971) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CHIC1 |
| Uniprot ID |
Q5JSZ4 |
| Protein Accession # |
NP_001034929 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001039840 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CHIC1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-CHIC1 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate |
|
|
