PARL Antibody - N-terminal region (ARP44851_P050)

Data Sheet
 
Product Number ARP44851_P050
Product Page www.avivasysbio.com/parl-antibody-n-terminal-region-arp44851-p050.html
Name PARL Antibody - N-terminal region (ARP44851_P050)
Protein Size (# AA) 329 amino acids
Molecular Weight 36kDa
NCBI Gene Id 55486
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Presenilin associated, rhomboid-like
Description
Alias Symbols PSARL, PSARL1, RHBDS1, PRO2207, PSENIP2
Peptide Sequence Synthetic peptide located within the following region: SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Walder,K., (2005) Diabetologia 48 (3), 459-468
Description of Target PARL is a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. PARL may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in its gene has been associated with increased risk for type 2 diabetes.This gene encodes a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. This gene may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in this gene has been associated with increased risk for type 2 diabetes. Alternative splicing results in multiple transcript variants encoding different isoforms.
Protein Interactions UBC; PINK1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PARL (ARP44851_P050) antibody
Additional Information IHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 0.5 ug/ml. Gel concentration: 12%.
Blocking Peptide For anti-PARL (ARP44851_P050) antibody is Catalog # AAP44851 (Previous Catalog # AAPP25930)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PARL
Uniprot ID Q9H300-2
Protein Name Presenilins-associated rhomboid-like protein, mitochondrial
Publications

Cholesterol alters mitophagy by impairing optineurin recruitment and lysosomal clearance in Alzheimer's disease. Mol Neurodegener. 16, 15 (2021) 33685483

Yoshioka, H. et al. The role of PARL and HtrA2 in striatal neuronal injury after transient global cerebral ischemia. J. Cereb. Blood Flow Metab. 33, 1658-65 (2013). 23921894

Sample Type Confirmation

PARL is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_001032728
Purification Affinity Purified
Nucleotide Accession # NM_001037639
Tested Species Reactivity Human
Gene Symbol PARL
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%;
Image 1
Human kidney
Human kidney
Image 2
Human Jurkat
Host: Rabbit
Target Name: PARL
Sample Tissue: Human Jurkat
Antibody Dilution: 1.0ug/ml
Image 3
Human Lung Tissue
Rabbit Anti-PARL Antibody
Catalog Number: ARP44851_P050
Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
Observed Staining: Cytoplasmic in alveolar type I cells
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com