website statistics
Product Datasheet: ARP44832_P050 - NRCAM antibody - N-terminal region (ARP44832_P050) - Aviva Systems Biology
 
NRCAM antibody - N-terminal region (ARP44832_P050)
Data Sheet
 
Product Number ARP44832_P050
Product Page www.avivasysbio.com/nrcam-antibody-n-terminal-region-arp44832-p050.html
Product Name NRCAM antibody - N-terminal region (ARP44832_P050)
Size 100 ul
Gene Symbol NRCAM
Alias Symbols KIAA0343, MGC138845, MGC138846
Protein Size (# AA) 771 amino acids
Molecular Weight 84kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 4897
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Neuronal cell adhesion molecule
Description This is a rabbit polyclonal antibody against NRCAM. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: PLILFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGK
Description of Target Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.
Protein Interactions LNX1; MAGI3; HSPA12A; MACF1; UBC; NFASC; NRCAM; CNTN2; PTPRB; ANK2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-NRCAM (ARP44832_P050) antibody is Catalog # AAP44832 (Previous Catalog # AAPP25912)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NRCAM
Complete computational species homology data Anti-NRCAM (ARP44832_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express NRCAM.
Swissprot Id Q4KMQ7
Protein Name NRCAM protein EMBL AAH98401.1
Protein Accession # AAH98401
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express NRCAM.
Nucleotide Accession # NM_001037132
Replacement Item This antibody may replace item sc-18958 from Santa Cruz Biotechnology.
Conjugation Options

ARP44832_P050-FITC Conjugated

ARP44832_P050-HRP Conjugated

ARP44832_P050-Biotin Conjugated

CB Replacement sc-18958; sc-18960
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-NRCAM Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com