| Product Number |
ARP44827_T100 |
| Product Page |
www.avivasysbio.com/retreg1-antibody-middle-region-arp44827-t100.html |
| Name |
RETREG1 Antibody - middle region (ARP44827_T100) |
| Protein Size (# AA) |
356 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
54463 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
reticulophagy regulator 1 |
| Description |
|
| Alias Symbols |
JK1, JK-1, FAM134B |
| Peptide Sequence |
Synthetic peptide located within the following region: LSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
The protein encoded by this gene is a cis-Golgi transmembrane protein that may be necessary for the long-term survival of nociceptive and autonomic ganglion neurons. Mutations in this gene are a cause of hereditary sensory and autonomic neuropathy type IIB (HSAN IIB), and this gene may also play a role in susceptibility to vascular dementia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Protein Interactions |
APP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RETREG1 (ARP44827_T100) antibody |
| Blocking Peptide |
For anti-RETREG1 (ARP44827_T100) antibody is Catalog # AAP44827 (Previous Catalog # AAPP25907) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human FAM134B |
| Uniprot ID |
Q9H6L5-2 |
| Protein Name |
reticulophagy regulator 1 |
| Publications |
FAM134B induces tumorigenesis and epithelial-to-mesenchymal transition via Akt signaling in hepatocellular carcinoma. Mol Oncol. 13, 792-810 (2019). 30556279 |
| Sample Type Confirmation |
FAM134B is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_061873 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_019000 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RETREG1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Lung
 | Human Lung |
|
| Image 2 | Human Jurkat
 | WB Suggested Anti-FAM134B Antibody Titration: 0.625ug/ml
Positive Control: Jurkat cell lysateFAM134B is supported by BioGPS gene expression data to be expressed in Jurkat |
|
