Product Number |
ARP44817_P050 |
Product Page |
www.avivasysbio.com/rhot1-antibody-n-terminal-region-arp44817-p050.html |
Name |
RHOT1 Antibody - N-terminal region (ARP44817_P050) |
Protein Size (# AA) |
618 amino acids |
Molecular Weight |
71 kDa |
NCBI Gene Id |
55288 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Ras homolog family member T1 |
Description |
|
Alias Symbols |
ARHT1, MIRO1, MIRO-1 |
Peptide Sequence |
Synthetic peptide located within the following region: MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Brandenberger,R., (2004) Nat. Biotechnol. 22 (6), 707-716 |
Description of Target |
Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution. |
Protein Interactions |
PCSK9; ERLIN2; PARK2; ILK; UBC; CFTR; PINK1; UBD; IRAK1; AMFR; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-RHOT1 (ARP44817_P050) antibody |
Additional Information |
IHC Information: HepG2 cell lysate. Antibody concentration: 0.25 ug/ml. Gel concentration: 12%. |
Blocking Peptide |
For anti-RHOT1 (ARP44817_P050) antibody is Catalog # AAP44817 (Previous Catalog # AAPP12293) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human RHOT1 |
Uniprot ID |
Q8IXI2 |
Protein Name |
Mitochondrial Rho GTPase 1 |
Publications |
Deacetylation of Miro1 by HDAC6 blocks mitochondrial transport and mediates axon growth inhibition. J Cell Biol. 218, 1871-1890 (2019). 31068376 |
Protein Accession # |
NP_060777 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_018307 |
Tested Species Reactivity |
Human |
Gene Symbol |
RHOT1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB, IP |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | mouse brain and human neuroblastoma
| mouse brain and human neuroblastoma |
|
Image 2 | Human Muscle
| Rabbit Anti-RHOT1 Antibody Catalog Number: ARP44817 Paraffin Embedded Tissue: Human Muscle Cellular Data: Skeletal muscle cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
Image 3 | Human Fetal Lung
| Host: Rabbit Target Name: RHOT1 Sample Type: Fetal Lung lysates Antibody Dilution: 1.0ug/ml |
|
Image 4 | Human A549 Whole Cell
| Host: Rabbit Target Name: RHOT1 Sample Tissue: Human A549 Whole Cell Antibody Dilution: 1ug/ml |
|
Image 5 | Human Fetal Lung
| Host: Rabbit Target Name: MIRO1 Sample Type: Fetal Lung lysates Antibody Dilution: 1.0ug/ml |
|
Image 6 |
| Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
|
|