RHOT1 Antibody - N-terminal region (ARP44817_P050)

Data Sheet
 
Product Number ARP44817_P050
Product Page www.avivasysbio.com/rhot1-antibody-n-terminal-region-arp44817-p050.html
Name RHOT1 Antibody - N-terminal region (ARP44817_P050)
Protein Size (# AA) 618 amino acids
Molecular Weight 71 kDa
NCBI Gene Id 55288
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ras homolog family member T1
Description
Alias Symbols ARHT1, MIRO1, MIRO-1
Peptide Sequence Synthetic peptide located within the following region: MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Brandenberger,R., (2004) Nat. Biotechnol. 22 (6), 707-716
Description of Target Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
Protein Interactions PCSK9; ERLIN2; PARK2; ILK; UBC; CFTR; PINK1; UBD; IRAK1; AMFR;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-RHOT1 (ARP44817_P050) antibody
Additional Information IHC Information: HepG2 cell lysate. Antibody concentration: 0.25 ug/ml. Gel concentration: 12%.
Blocking Peptide For anti-RHOT1 (ARP44817_P050) antibody is Catalog # AAP44817 (Previous Catalog # AAPP12293)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RHOT1
Uniprot ID Q8IXI2
Protein Name Mitochondrial Rho GTPase 1
Publications

Deacetylation of Miro1 by HDAC6 blocks mitochondrial transport and mediates axon growth inhibition. J Cell Biol. 218, 1871-1890 (2019). 31068376

Protein Accession # NP_060777
Purification Affinity Purified
Nucleotide Accession # NM_018307
Tested Species Reactivity Human
Gene Symbol RHOT1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB, IP
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
mouse brain and human neuroblastoma
mouse brain and human neuroblastoma
Image 2
Human Muscle
Rabbit Anti-RHOT1 Antibody
Catalog Number: ARP44817
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 3
Human Fetal Lung
Host: Rabbit
Target Name: RHOT1
Sample Type: Fetal Lung lysates
Antibody Dilution: 1.0ug/ml
Image 4
Human A549 Whole Cell
Host: Rabbit
Target Name: RHOT1
Sample Tissue: Human A549 Whole Cell
Antibody Dilution: 1ug/ml
Image 5
Human Fetal Lung
Host: Rabbit
Target Name: MIRO1
Sample Type: Fetal Lung lysates
Antibody Dilution: 1.0ug/ml
Image 6

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com