Product Number |
ARP44805_T100 |
Product Page |
www.avivasysbio.com/usp48-antibody-middle-region-arp44805-t100.html |
Name |
USP48 Antibody - middle region (ARP44805_T100) |
Protein Size (# AA) |
640 amino acids |
Molecular Weight |
70kDa |
NCBI Gene Id |
84196 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Ubiquitin specific peptidase 48 |
Alias Symbols |
USP31, RAP1GA1 |
Peptide Sequence |
Synthetic peptide located within the following region: ALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
USP48 is a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. |
Protein Interactions |
SLC9A3; DRD3; BRAT1; VPS35; SEC24D; PSAP; UBC; ZC3HAV1; UBA6; UACA; ZFR; UCHL3; APP; EEF1B2P5; USP21; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-USP48 (ARP44805_T100) antibody |
Blocking Peptide |
For anti-USP48 (ARP44805_T100) antibody is Catalog # AAP44805 (Previous Catalog # AAPP12281) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human USP48 |
Uniprot ID |
Q86UV5 |
Protein Name |
Ubiquitin carboxyl-terminal hydrolase 48 |
Sample Type Confirmation |
USP48 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
AAH67261 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001032730 |
Tested Species Reactivity |
Human |
Gene Symbol |
USP48 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-USP48 Antibody Titration: 2.5ug/ml Positive Control: HepG2 cell lysateUSP48 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells |
|