USP48 Antibody - middle region (ARP44805_T100)

Data Sheet
 
Product Number ARP44805_T100
Product Page www.avivasysbio.com/usp48-antibody-middle-region-arp44805-t100.html
Name USP48 Antibody - middle region (ARP44805_T100)
Protein Size (# AA) 640 amino acids
Molecular Weight 70kDa
NCBI Gene Id 84196
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Ubiquitin specific peptidase 48
Alias Symbols USP31, RAP1GA1
Peptide Sequence Synthetic peptide located within the following region: ALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target USP48 is a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.
Protein Interactions SLC9A3; DRD3; BRAT1; VPS35; SEC24D; PSAP; UBC; ZC3HAV1; UBA6; UACA; ZFR; UCHL3; APP; EEF1B2P5; USP21;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-USP48 (ARP44805_T100) antibody
Blocking Peptide For anti-USP48 (ARP44805_T100) antibody is Catalog # AAP44805 (Previous Catalog # AAPP12281)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human USP48
Uniprot ID Q86UV5
Protein Name Ubiquitin carboxyl-terminal hydrolase 48
Sample Type Confirmation

USP48 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # AAH67261
Purification Protein A purified
Nucleotide Accession # NM_001032730
Tested Species Reactivity Human
Gene Symbol USP48
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-USP48 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysateUSP48 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com