| Product Number |
ARP44803_P050 |
| Product Page |
www.avivasysbio.com/spint1-antibody-middle-region-arp44803-p050.html |
| Name |
SPINT1 Antibody - middle region (ARP44803_P050) |
| Protein Size (# AA) |
513 amino acids |
| Molecular Weight |
53kDa |
| NCBI Gene Id |
6692 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Serine peptidase inhibitor, Kunitz type 1 |
| Alias Symbols |
HAI, HAI1, MANSC2 |
| Peptide Sequence |
Synthetic peptide located within the following region: PFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF in injured t |
| Protein Interactions |
FAM46A; UBQLN4; UBC; ST14; HGFAC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SPINT1 (ARP44803_P050) antibody |
| Blocking Peptide |
For anti-SPINT1 (ARP44803_P050) antibody is Catalog # AAP44803 (Previous Catalog # AAPP12279) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SPINT1 |
| Uniprot ID |
B2RBU9 |
| Protein Name |
cDNA, FLJ95704, highly similar to Homo sapiens serine protease inhibitor, Kunitz type 1 (SPINT1), mRNA EMBL BAG37346.1 |
| Protein Accession # |
NP_001027539 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001032367 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SPINT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Fetal Lung
 | Host: Rabbit
Target Name: SPINT1
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml |
| | Image 2 | Human PANC1
 | WB Suggested Anti-SPINT1 Antibody Titration: 0.2-1 ug/ml
Positive Control: PANC1 cell lysate |
|
|
