Product Number |
ARP44797_T100 |
Product Page |
www.avivasysbio.com/rce1-antibody-n-terminal-region-arp44797-t100.html |
Name |
RCE1 Antibody - N-terminal region (ARP44797_T100) |
Protein Size (# AA) |
329 amino acids |
Molecular Weight |
36 kDa |
NCBI Gene Id |
9986 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Ras converting CAAX endopeptidase 1 |
Alias Symbols |
FACE2, RCE1A, RCE1B |
Peptide Sequence |
Synthetic peptide located within the following region: WARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Plummer,L.J., (2006) J. Biol. Chem. 281 (8), 4596-4605 |
Description of Target |
This gene encodes an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-RCE1 (ARP44797_T100) antibody |
Blocking Peptide |
For anti-RCE1 (ARP44797_T100) antibody is Catalog # AAP44797 (Previous Catalog # AAPP12273) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human RCE1 |
Uniprot ID |
Q9Y256 |
Protein Name |
CAAX prenyl protease 2 |
Sample Type Confirmation |
RCE1 is supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
NP_005124 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_005133 |
Tested Species Reactivity |
Human |
Gene Symbol |
RCE1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | Human Muscle
| Human Muscle |
|
Image 2 | Western Blot
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. |
|