RCE1 Antibody - N-terminal region (ARP44797_T100)

Data Sheet
 
Product Number ARP44797_T100
Product Page www.avivasysbio.com/rce1-antibody-n-terminal-region-arp44797-t100.html
Name RCE1 Antibody - N-terminal region (ARP44797_T100)
Protein Size (# AA) 329 amino acids
Molecular Weight 36 kDa
NCBI Gene Id 9986
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Ras converting CAAX endopeptidase 1
Alias Symbols FACE2, RCE1A, RCE1B
Peptide Sequence Synthetic peptide located within the following region: WARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Plummer,L.J., (2006) J. Biol. Chem. 281 (8), 4596-4605
Description of Target This gene encodes an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-RCE1 (ARP44797_T100) antibody
Blocking Peptide For anti-RCE1 (ARP44797_T100) antibody is Catalog # AAP44797 (Previous Catalog # AAPP12273)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RCE1
Uniprot ID Q9Y256
Protein Name CAAX prenyl protease 2
Sample Type Confirmation

RCE1 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_005124
Purification Protein A purified
Nucleotide Accession # NM_005133
Tested Species Reactivity Human
Gene Symbol RCE1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human Muscle
Human Muscle
Image 2
Western Blot
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com