Product Number |
ARP44737_P050 |
Product Page |
www.avivasysbio.com/lrrc24-antibody-n-terminal-region-arp44737-p050.html |
Name |
LRRC24 Antibody - N-terminal region (ARP44737_P050) |
Protein Size (# AA) |
513 amino acids |
Molecular Weight |
55kDa |
NCBI Gene Id |
441381 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Leucine rich repeat containing 24 |
Alias Symbols |
LRRC14OS |
Peptide Sequence |
Synthetic peptide located within the following region: PLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVGL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004) |
Description of Target |
LRRC24 contains 1 Ig-like C2-type (immunoglobulin-like) domain and 7 LRR (leucine-rich) repeats. It is a single-pass membrane protein. The function of the LRRC24 protein remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LRRC24 (ARP44737_P050) antibody |
Blocking Peptide |
For anti-LRRC24 (ARP44737_P050) antibody is Catalog # AAP44737 (Previous Catalog # AAPP12213) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC24 |
Uniprot ID |
Q50LG9 |
Protein Name |
Leucine-rich repeat-containing protein 24 |
Protein Accession # |
NP_001019849 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001024678 |
Tested Species Reactivity |
Human |
Gene Symbol |
LRRC24 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 85%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
Image 1 | Human HeLa
| WB Suggested Anti-LRRC24 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Hela cell lysate |
|
|