LRRC24 Antibody - N-terminal region (ARP44737_P050)

• Product Number: ARP44737_P050
• Name: LRRC24 Antibody - N-terminal region (ARP44737_P050)
• Protein Size (# AA): 513 amino acids
• Molecular Weight: 55kDa
• NCBI Gene Id: 441381
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Leucine rich repeat containing 24
• Alias Symbols: LRRC14OS
• Peptide Sequence: Synthetic peptide located within the following region: PLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVGL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
• Description of Target: LRRC24 contains 1 Ig-like C2-type (immunoglobulin-like) domain and 7 LRR (leucine-rich) repeats. It is a single-pass membrane protein. The function of the LRRC24 protein remains unknown.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-LRRC24 (ARP44737_P050) antibody is Catalog # AAP44737 (Previous Catalog # AAPP12213)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC24
• Uniprot ID: Q50LG9
• Protein Name: Leucine-rich repeat-containing protein 24
• Protein Accession #: NP_001019849
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001024678
• Tested Species Reactivity: Human
• Gene Symbol: LRRC24
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 85%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Image 1: Human HeLa
  
  WB Suggested Anti-LRRC24 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Hela cell lysate