VMA21 Antibody - N-terminal region (ARP44721_T100)

• Product Number: ARP44721_T100
• Name: VMA21 Antibody - N-terminal region (ARP44721_T100)
• Protein Size (# AA): 101 amino acids
• Molecular Weight: 11kDa
• NCBI Gene Id: 203547
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: VMA21 vacuolar H+-ATPase homolog (S. cerevisiae)
• Alias Symbols: MEAX, XMEA
• Peptide Sequence: Synthetic peptide located within the following region: MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45
• Description of Target: The function remains unknown.
• Protein Interactions: K3; TMEM9; COA7; SCAF4; NPTN; SEPT9; PLIN3; SELENBP1; PLAUR; OXCT1; ECE1; ELAVL1; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-VMA21 (ARP44721_T100) antibody is Catalog # AAP44721 (Previous Catalog # AAPP12193)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC203547
• Uniprot ID: Q3ZAQ7
• Protein Name: Vacuolar ATPase assembly integral membrane protein VMA21
• Protein Accession #: NP_001017980
• Purification: Protein A purified
• Nucleotide Accession #: NM_001017980
• Tested Species Reactivity: Human
• Gene Symbol: VMA21
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 86%; Human: 100%; Mouse: 93%; Pig: 92%; Rabbit: 93%; Rat: 93%
• Image 1: Human kidney
  
  Human kidney
• Image 2: Human HepG2
  
  WB Suggested Anti-VMA21 Antibody Titration: 5.0ug/ml
  Positive Control: HepG2 cell lysate