| Product Number |
ARP44701_T100 |
| Product Page |
www.avivasysbio.com/mgat2-antibody-middle-region-arp44701-t100.html |
| Name |
MGAT2 Antibody - middle region (ARP44701_T100) |
| Protein Size (# AA) |
447 amino acids |
| Molecular Weight |
51kDa |
| NCBI Gene Id |
4247 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase |
| Alias Symbols |
GNT2, CDG2A, CDGS2, GNT-II, GLCNACTII |
| Peptide Sequence |
Synthetic peptide located within the following region: PKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKILRD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Otsuki,T., (2005) DNA Res. 12 (2), 117-126 |
| Description of Target |
MGAT2 is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in its gene may lead to carbohydrate-deficient glycoprotein syndrome, type II.The product of this gene is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in this gene may lead to carbohydrate-deficient glycoprotein syndrome, type II. Two transcript variants encoding the same protein have been identified for this gene. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MGAT2 (ARP44701_T100) antibody |
| Blocking Peptide |
For anti-MGAT2 (ARP44701_T100) antibody is Catalog # AAP44701 (Previous Catalog # AAPP12173) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MGAT2 |
| Uniprot ID |
Q10469 |
| Protein Name |
Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase |
| Protein Accession # |
NP_002399 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_002408 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MGAT2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-MGAT2 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate |
|
| Image 2 | Human kidney
 | Human kidney |
|
