PTRH2 Antibody - C-terminal region (ARP44695_T100)

• Product Number: ARP44695_T100
• Name: PTRH2 Antibody - C-terminal region (ARP44695_T100)
• Protein Size (# AA): 180 amino acids
• Molecular Weight: 20kDa
• NCBI Gene Id: 51651
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Peptidyl-tRNA hydrolase 2
• Alias Symbols: PTH, BIT1, PTH2, PTH 2, CFAP37, IMNEPD, CGI-147
• Peptide Sequence: Synthetic peptide located within the following region: RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Jan,Y., (2004) Cell 116 (5), 751-762
• Description of Target: The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.
• Protein Interactions: MDM2; PTK2; UBC; ATP6V0A2; FLOT1; LAMTOR3; RPS15; RPS2; JUP; FLOT2; CD55; ABCC2; ATP6V0A1; STT3B; GADD45GIP1; ATP6V1D; AES;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PTRH2 (ARP44695_T100) antibody is Catalog # AAP44695 (Previous Catalog # AAPP12167)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PTRH2
• Uniprot ID: Q9Y3E5
• Protein Accession #: NP_001015509
• Purification: Protein A purified
• Nucleotide Accession #: NM_001015509
• Tested Species Reactivity: Human
• Gene Symbol: PTRH2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 92%
• Image 1: Human Jurkat
  
  WB Suggested Anti-PTRH2 Antibody Titration: 1.25ug/ml
  Positive Control: Jurkat cell lysate