Product Number |
ARP44688_T100 |
Product Page |
www.avivasysbio.com/gltpd2-antibody-middle-region-arp44688-t100.html |
Name |
GLTPD2 Antibody - middle region (ARP44688_T100) |
Protein Size (# AA) |
291 amino acids |
Molecular Weight |
32kDa |
NCBI Gene Id |
388323 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Glycolipid transfer protein domain containing 2 |
Peptide Sequence |
Synthetic peptide located within the following region: LAAMAAWERRAGLLEQPGAAPRDPTRSSGSRTLLLLHRALRWSQLCLHRV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
Description of Target |
The function remains unknown. |
Protein Interactions |
PRDX4; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GLTPD2 (ARP44688_T100) antibody |
Blocking Peptide |
For anti-GLTPD2 (ARP44688_T100) antibody is Catalog # AAP44688 (Previous Catalog # AAPP12160) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LOC388323 |
Uniprot ID |
A6NH11 |
Protein Name |
Glycolipid transfer protein domain-containing protein 2 |
Protein Accession # |
NP_001014985 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001014985 |
Tested Species Reactivity |
Human |
Gene Symbol |
GLTPD2 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-GLTPD2 Antibody Titration: 5.0ug/ml Positive Control: Jurkat cell lysate |
|
|