GLTPD2 Antibody - middle region (ARP44688_T100)

Data Sheet
 
Product Number ARP44688_T100
Product Page www.avivasysbio.com/gltpd2-antibody-middle-region-arp44688-t100.html
Name GLTPD2 Antibody - middle region (ARP44688_T100)
Protein Size (# AA) 291 amino acids
Molecular Weight 32kDa
NCBI Gene Id 388323
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Glycolipid transfer protein domain containing 2
Peptide Sequence Synthetic peptide located within the following region: LAAMAAWERRAGLLEQPGAAPRDPTRSSGSRTLLLLHRALRWSQLCLHRV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Description of Target The function remains unknown.
Protein Interactions PRDX4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GLTPD2 (ARP44688_T100) antibody
Blocking Peptide For anti-GLTPD2 (ARP44688_T100) antibody is Catalog # AAP44688 (Previous Catalog # AAPP12160)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LOC388323
Uniprot ID A6NH11
Protein Name Glycolipid transfer protein domain-containing protein 2
Protein Accession # NP_001014985
Purification Protein A purified
Nucleotide Accession # NM_001014985
Tested Species Reactivity Human
Gene Symbol GLTPD2
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-GLTPD2 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com