Product Number |
ARP44685_T100 |
Product Page |
www.avivasysbio.com/tm9sf1-antibody-middle-region-arp44685-t100.html |
Name |
TM9SF1 Antibody - middle region (ARP44685_T100) |
Protein Size (# AA) |
606 amino acids |
Molecular Weight |
67kDa |
NCBI Gene Id |
10548 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Transmembrane 9 superfamily member 1 |
Alias Symbols |
MP70, HMP70 |
Peptide Sequence |
Synthetic peptide located within the following region: THTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Sugasawa,T., (2001) Gene 273 (2), 227-237 |
Description of Target |
TM9SF1 may function as channel, small molecule transporter or receptor. |
Protein Interactions |
RNASEH1; TCOF1; P2RX7; ATP6V1B1; UBC; MME; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TM9SF1 (ARP44685_T100) antibody |
Blocking Peptide |
For anti-TM9SF1 (ARP44685_T100) antibody is Catalog # AAP44685 (Previous Catalog # AAPP12157) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TM9SF1 |
Uniprot ID |
O15321 |
Protein Name |
Transmembrane 9 superfamily member 1 |
Protein Accession # |
NP_006396 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_006405 |
Tested Species Reactivity |
Human |
Gene Symbol |
TM9SF1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human kidney
| Human kidney |
| Image 2 | Human Jurkat
| WB Suggested Anti-TM9SF1 Antibody Titration: 2.5ug/ml Positive Control: Jurkat cell lysate |
|
|