TM9SF1 Antibody - middle region (ARP44685_T100)

Data Sheet
 
Product Number ARP44685_T100
Product Page www.avivasysbio.com/tm9sf1-antibody-middle-region-arp44685-t100.html
Name TM9SF1 Antibody - middle region (ARP44685_T100)
Protein Size (# AA) 606 amino acids
Molecular Weight 67kDa
NCBI Gene Id 10548
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Transmembrane 9 superfamily member 1
Alias Symbols MP70, HMP70
Peptide Sequence Synthetic peptide located within the following region: THTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sugasawa,T., (2001) Gene 273 (2), 227-237
Description of Target TM9SF1 may function as channel, small molecule transporter or receptor.
Protein Interactions RNASEH1; TCOF1; P2RX7; ATP6V1B1; UBC; MME;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TM9SF1 (ARP44685_T100) antibody
Blocking Peptide For anti-TM9SF1 (ARP44685_T100) antibody is Catalog # AAP44685 (Previous Catalog # AAPP12157)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TM9SF1
Uniprot ID O15321
Protein Name Transmembrane 9 superfamily member 1
Protein Accession # NP_006396
Purification Protein A purified
Nucleotide Accession # NM_006405
Tested Species Reactivity Human
Gene Symbol TM9SF1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human kidney
Human kidney
Image 2
Human Jurkat
WB Suggested Anti-TM9SF1 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com