Product Number |
ARP44652_P050 |
Product Page |
www.avivasysbio.com/awat1-antibody-n-terminal-region-arp44652-p050.html |
Name |
AWAT1 Antibody - N-terminal region (ARP44652_P050) |
Protein Size (# AA) |
328 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
158833 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Acyl-CoA wax alcohol acyltransferase 1 |
Alias Symbols |
DGA2, DGAT2L3 |
Peptide Sequence |
Synthetic peptide located within the following region: LLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-AWAT1 (ARP44652_P050) antibody |
Blocking Peptide |
For anti-AWAT1 (ARP44652_P050) antibody is Catalog # AAP44652 (Previous Catalog # AAPP12124) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human AWAT1 |
Uniprot ID |
Q58HT5 |
Protein Name |
Acyl-CoA wax alcohol acyltransferase 1 |
Protein Accession # |
NP_001013597 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001013579 |
Tested Species Reactivity |
Human |
Gene Symbol |
AWAT1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Zebrafish: 92% |
Image 1 | Human Spleen
| WB Suggested Anti-AWAT1 Antibody Titration: 0.2-1 ug/ml Positive Control: Human Spleen |
|
|