| Product Number |
ARP44651_P050 |
| Product Page |
www.avivasysbio.com/awat1-antibody-n-terminal-region-arp44651-p050.html |
| Name |
AWAT1 Antibody - N-terminal region (ARP44651_P050) |
| Protein Size (# AA) |
328 amino acids |
| Molecular Weight |
38kDa |
| NCBI Gene Id |
158833 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Acyl-CoA wax alcohol acyltransferase 1 |
| Alias Symbols |
DGA2, DGAT2L3 |
| Peptide Sequence |
Synthetic peptide located within the following region: NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-AWAT1 (ARP44651_P050) antibody |
| Blocking Peptide |
For anti-AWAT1 (ARP44651_P050) antibody is Catalog # AAP44651 (Previous Catalog # AAPP12123) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human AWAT1 |
| Uniprot ID |
Q58HT5 |
| Protein Name |
Acyl-CoA wax alcohol acyltransferase 1 |
| Protein Accession # |
NP_001013597 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001013579 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
AWAT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 93%; Guinea Pig: 85%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86% |
| Image 1 | Human Stomach
 | WB Suggested Anti-AWAT1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Stomach |
|
|
