Product Number |
ARP44585_P050 |
Product Page |
www.avivasysbio.com/c20orf30-antibody-c-terminal-region-arp44585-p050.html |
Name |
C20orf30 Antibody - C-terminal region (ARP44585_P050) |
Protein Size (# AA) |
120 amino acids |
Molecular Weight |
13kDa |
NCBI Gene Id |
29058 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Transmembrane protein 230 |
Alias Symbols |
HSPC274, C20orf30, dJ1116H23.2.1 |
Peptide Sequence |
Synthetic peptide located within the following region: KGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270 |
Description of Target |
The exact function of C20orf30 remains unknown. |
Protein Interactions |
UBC; LMNA; VKORC1; TMEM9; RPL28; ARL4D; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TMEM230 (ARP44585_P050) antibody |
Blocking Peptide |
For anti-TMEM230 (ARP44585_P050) antibody is Catalog # AAP44585 (Previous Catalog # AAPP25852) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human C20orf30 |
Uniprot ID |
Q96A57 |
Protein Name |
Transmembrane protein 230 |
Protein Accession # |
NP_054864 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_014145 |
Tested Species Reactivity |
Human |
Gene Symbol |
TMEM230 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human 293T
| WB Suggested Anti-C20orf30 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: 293T cell lysate |
|