LST-3TM12 Antibody - middle region (ARP44578_P050)

Data Sheet
 
Product Number ARP44578_P050
Product Page www.avivasysbio.com/lst-3tm12-antibody-middle-region-arp44578-p050.html
Name LST-3TM12 Antibody - middle region (ARP44578_P050)
Protein Size (# AA) 640 amino acids
Molecular Weight 71kDa
NCBI Gene Id 338821
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Solute carrier organic anion transporter family, member 1B7 (non-functional)
Alias Symbols LST3, LST-3, SLC21A21, LST-3TM12
Peptide Sequence Synthetic peptide located within the following region: LKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The exact function of LST-3TM12 remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SLCO1B7 (ARP44578_P050) antibody
Blocking Peptide For anti-SLCO1B7 (ARP44578_P050) antibody is Catalog # AAP44578 (Previous Catalog # AAPP12094)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LST-3TM12
Uniprot ID Q71QF0
Protein Name Putative solute carrier organic anion transporter family member 1B7
Protein Accession # NP_001009562
Purification Affinity Purified
Nucleotide Accession # NM_001009562
Tested Species Reactivity Human
Gene Symbol SLCO1B7
Predicted Species Reactivity Human, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Rat: 91%
Image 1
Human Lung
WB Suggested Anti-LST-3TM12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com