Product Number |
ARP44578_P050 |
Product Page |
www.avivasysbio.com/lst-3tm12-antibody-middle-region-arp44578-p050.html |
Name |
LST-3TM12 Antibody - middle region (ARP44578_P050) |
Protein Size (# AA) |
640 amino acids |
Molecular Weight |
71kDa |
NCBI Gene Id |
338821 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Solute carrier organic anion transporter family, member 1B7 (non-functional) |
Alias Symbols |
LST3, LST-3, SLC21A21, LST-3TM12 |
Peptide Sequence |
Synthetic peptide located within the following region: LKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The exact function of LST-3TM12 remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SLCO1B7 (ARP44578_P050) antibody |
Blocking Peptide |
For anti-SLCO1B7 (ARP44578_P050) antibody is Catalog # AAP44578 (Previous Catalog # AAPP12094) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LST-3TM12 |
Uniprot ID |
Q71QF0 |
Protein Name |
Putative solute carrier organic anion transporter family member 1B7 |
Protein Accession # |
NP_001009562 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001009562 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLCO1B7 |
Predicted Species Reactivity |
Human, Rat |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Rat: 91% |
Image 1 | Human Lung
| WB Suggested Anti-LST-3TM12 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human Lung |
|
|