| Product Number |
ARP44576_T100 |
| Product Page |
www.avivasysbio.com/mfap3l-antibody-n-terminal-region-arp44576-t100.html |
| Name |
MFAP3L Antibody - N-terminal region (ARP44576_T100) |
| Protein Size (# AA) |
409 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
9848 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Microfibrillar-associated protein 3-like |
| Alias Symbols |
NYD-sp9 |
| Peptide Sequence |
Synthetic peptide located within the following region: MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Yang,C.B., Unpublished (2003) |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MFAP3L (ARP44576_T100) antibody |
| Blocking Peptide |
For anti-MFAP3L (ARP44576_T100) antibody is Catalog # AAP44576 (Previous Catalog # AAPP12092) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MFAP3L |
| Uniprot ID |
O75121 |
| Protein Name |
Microfibrillar-associated protein 3-like |
| Protein Accession # |
NP_067679 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_021647 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MFAP3L |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-MFAP3L Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate |
|
|
