SDCBP Antibody - middle region (ARP44535_T100)

• Product Number: ARP44535_T100
• Name: SDCBP Antibody - middle region (ARP44535_T100)
• Protein Size (# AA): 298 amino acids
• Molecular Weight: 32kDa
• NCBI Gene Id: 6386
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Syndecan binding protein (syntenin)
• Alias Symbols: ST1, MDA9, SYCL, MDA-9, TACIP18
• Peptide Sequence: Synthetic peptide located within the following region: VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Boukerche,H., (2005) Cancer Res. 65 (23), 10901-10911
• Description of Target: SDCBP was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus.The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Protein Interactions: WASL; SSNA1; CADPS; CGGBP1; ZBTB14; UBE2A; UBC; TRAF5; TFCP2; TDO2; FAM118B; DCTPP1; PYCRL; NADK; CDCP1; RIC8A; KLHL12; HOMEZ; TRIM54; EIF5A2; SEPT3; PRPF40A; NAGK; C11orf57; CEP55; ENOX1; FAM118A; THG1L; C1orf109; ZCCHC10; KCTD9; ROPN1; LZTFL1; NECAB2; P
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-SDCBP (ARP44535_T100) antibody is Catalog # AAP44535 (Previous Catalog # AAPP12051)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SDCBP
• Uniprot ID: O00560
• Protein Name: Syntenin-1
• Protein Accession #: NP_001007068
• Purification: Protein A purified
• Nucleotide Accession #: NM_001007067
• Tested Species Reactivity: Human
• Gene Symbol: SDCBP
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Image 1: Human kidney
  
  Human kidney
• Image 2: Human HepG2
  
  WB Suggested Anti-SDCBP Antibody Titration: 1.25ug/ml
  Positive Control: HepG2 cell lysate