WDR33 Antibody - middle region (ARP44527_P050)

• Product Number: ARP44527_P050
• Name: WDR33 Antibody - middle region (ARP44527_P050)
• Protein Size (# AA): 257 amino acids
• Molecular Weight: 30kDa
• NCBI Gene Id: 55339
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: WD repeat domain 33
• Alias Symbols: NET14, WDC146
• Peptide Sequence: Synthetic peptide located within the following region: TKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETIL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
• Description of Target: WDR33 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or DNA recombination.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or DNA recombination. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Protein Interactions: SUMO1; WWOX; RPA3; RPA2; RPA1; BMI1; CLK2; CDK6; DYRK4; HDAC11; UBC; CDK4; MDC1; BARD1; ZNF622; FIP1L1; CPSF2; CPSF3; CPSF1; MED17; ISG15; HNRNPA1; ELAVL1; SMARCAD1; RBM48; ZBTB16; EEF1G; ZHX1; KAT7; UTP14A; GIT1; SH3GL3; PRMT1; TP53; TGFBR1; PFN2; RNPS1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-WDR33 (ARP44527_P050) antibody is Catalog # AAP44527 (Previous Catalog # AAPP12043)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR33
• Uniprot ID: Q6NUQ0
• Protein Name: pre-mRNA 3' end processing protein WDR33
• Sample Type Confirmation:

  WDR33 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_001006624
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001006623
• Tested Species Reactivity: Human
• Gene Symbol: WDR33
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 100%
• Image 1: Human 293T
  
  Lanes:
  1: SREC pulldown from lysate from 10^6 human 293T cells
  Primary Antibody Dilution:
  1:1000
  Secondary Antibody:
  Anti-rabbit-Alexa Fluor
  Secondary Antibody Dilution:
  1:5000
  Gene Name:
  WDR33
  Submitted by:
  Anonymous
  
• Image 2: Human HepG2
  
  WB Suggested Anti-WDR33 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: HepG2 cell lysateWDR33 is supported by BioGPS gene expression data to be expressed in HepG2
• Image 3: Human HepG2
  
  Host: Rabbit
  Target Name: WDR33
  Sample Type: Human HepG2
  Antibody Dilution: 1.0ug/mlWDR33 is supported by BioGPS gene expression data to be expressed in HepG2