WDR33 Antibody - N-terminal region (ARP44526_P050)

Data Sheet
 
Product Number ARP44526_P050
Product Page www.avivasysbio.com/wdr33-antibody-n-terminal-region-arp44526-p050.html
Name WDR33 Antibody - N-terminal region (ARP44526_P050)
Protein Size (# AA) 326 amino acids
Molecular Weight 38kDa
NCBI Gene Id 55339
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name WD repeat domain 33
Alias Symbols NET14, WDC146
Peptide Sequence Synthetic peptide located within the following region: IWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target WDR33 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or DNA recombination.
Protein Interactions SUMO1; WWOX; RPA3; RPA2; RPA1; BMI1; CLK2; CDK6; DYRK4; HDAC11; UBC; CDK4; MDC1; BARD1; ZNF622; FIP1L1; CPSF2; CPSF3; CPSF1; MED17; ISG15; HNRNPA1; ELAVL1; SMARCAD1; RBM48; ZBTB16; EEF1G; ZHX1; KAT7; UTP14A; GIT1; SH3GL3; PRMT1; TP53; TGFBR1; PFN2; RNPS1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-WDR33 (ARP44526_P050) antibody
Blocking Peptide For anti-WDR33 (ARP44526_P050) antibody is Catalog # AAP44526 (Previous Catalog # AAPP12042)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human WDR33
Uniprot ID Q9NUL1
Protein Name pre-mRNA 3' end processing protein WDR33
Protein Accession # NP_001006623
Purification Affinity Purified
Nucleotide Accession # NM_001006622
Tested Species Reactivity Human
Gene Symbol WDR33
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Image 1
Human THP-1
WB Suggested Anti-WDR33 Antibody Titration: 0.2-1 ug/ml
Positive Control: THP-1 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com