| Product Number |
ARP44502_P050 |
| Product Page |
www.avivasysbio.com/ttyh1-antibody-n-terminal-region-arp44502-p050.html |
| Name |
TTYH1 Antibody - N-terminal region (ARP44502_P050) |
| Protein Size (# AA) |
450 amino acids |
| Molecular Weight |
49kDa |
| NCBI Gene Id |
57348 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Tweety homolog 1 (Drosophila) |
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Suzuki,M. (2004) J. Biol. Chem. 279 (21), 22461-22468 |
| Description of Target |
TTYH1 is a member of the tweety family of proteins. Members of this family function as chloride anion channels. TTYH1 functions as a calcium (2+)-independent, volume-sensitive large conductance chloride (-) channel. This gene encodes a member of the tweety family of proteins. Members of this family function as chloride anion channels. The encoded protein functions as a calcium(2+)-independent, volume-sensitive large conductance chloride(-) channel. Two transcript variants encoding distinct isoforms have been identified for this gene. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TTYH1 (ARP44502_P050) antibody |
| Blocking Peptide |
For anti-TTYH1 (ARP44502_P050) antibody is Catalog # AAP44502 (Previous Catalog # AAPP12018) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TTYH1 |
| Uniprot ID |
Q9H313 |
| Protein Name |
Protein tweety homolog 1 |
| Protein Accession # |
NP_065710 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_020659 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TTYH1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HeLa
 | WB Suggested Anti-TTYH1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate |
|
|
