| Product Number |
ARP44499_P050 |
| Product Page |
www.avivasysbio.com/gpnmb-antibody-n-terminal-region-arp44499-p050.html |
| Name |
GPNMB Antibody - N-terminal region (ARP44499_P050) |
| Protein Size (# AA) |
560 amino acids |
| Molecular Weight |
63 kDa |
| NCBI Gene Id |
10457 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Glycoprotein (transmembrane) nmb |
| Alias Symbols |
NMB, HGFIN, PLCA3 |
| Peptide Sequence |
Synthetic peptide located within the following region: DENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954 |
| Description of Target |
GPNMB is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential.The protein encoded by this gene is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. Two transcript variants encoding different isoforms have been found for this gene. |
| Protein Interactions |
UBC; SMAD4; ITSN2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-GPNMB (ARP44499_P050) antibody |
| Specificity |
100% homologous to both isoforms of hGPNMB |
| Additional Information |
IHC Information: HepG2 cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 12%. |
| Blocking Peptide |
For anti-GPNMB (ARP44499_P050) antibody is Catalog # AAP44499 (Previous Catalog # AAPP12015) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GPNMB |
| Uniprot ID |
Q14956 |
| Protein Name |
cDNA FLJ78601, highly similar to Homo sapiens glycoprotein (transmembrane) nmb (GPNMB), transcript variant 2, mRNA EMBL BAF84767.1 |
| Protein Accession # |
NP_002501 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_002510 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GPNMB |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 79%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93% |
| Image 1 | Human Lung
 | Human Lung |
|
| Image 2 | Human Fetal Lung
 | Host: Rabbit
Target Name: GPNMB
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0ug/ml |
|
| Image 3 | Western Blot
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL |
|
