| Product Number |
ARP44434_P050 |
| Product Page |
www.avivasysbio.com/fmo3-antibody-n-terminal-region-arp44434-p050.html |
| Name |
FMO3 Antibody - N-terminal region (ARP44434_P050) |
| Protein Size (# AA) |
532 amino acids |
| Molecular Weight |
59kDa |
| NCBI Gene Id |
2328 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Flavin containing monooxygenase 3 |
| Description |
|
| Alias Symbols |
TMAU, FMOII, dJ127D3.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Zhang,J. (2006) Drug Metab. Dispos. 34 (1), 19-26 |
| Description of Target |
FMO3 is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. It acts on TMA to produce TMA-N-oxide. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FMO3 (ARP44434_P050) antibody |
| Blocking Peptide |
For anti-FMO3 (ARP44434_P050) antibody is Catalog # AAP44434 (Previous Catalog # AAPP25744) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FMO3 |
| Uniprot ID |
P31513 |
| Protein Name |
Dimethylaniline monooxygenase [N-oxide-forming] 3 |
| Protein Accession # |
NP_001002294 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001002294 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FMO3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 90%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-FMO3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
| Image 2 | Human Liver Tissue
 | FMO3 antibody - N-terminal region (ARP44434_P050)
Catalog Number: ARP44434_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Cytoplasm in sinusoids of liver
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
