ZFYVE27 Antibody - C-terminal region (ARP44429_T100)

• Product Number: ARP44429_T100
• Name: ZFYVE27 Antibody - C-terminal region (ARP44429_T100)
• Protein Size (# AA): 416 amino acids
• Molecular Weight: 46kDa
• NCBI Gene Id: 118813
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger, FYVE domain containing 27
• Alias Symbols: SPG33, PROTRUDIN
• Peptide Sequence: Synthetic peptide located within the following region: TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP.
• Protein Interactions: APP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZFYVE27 (ARP44429_T100) antibody is Catalog # AAP44429 (Previous Catalog # AAPP25739)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZFYVE27
• Uniprot ID: Q5T4F4-3
• Protein Name: Protrudin
• Protein Accession #: NP_001002261
• Purification: Protein A purified
• Nucleotide Accession #: NM_001002261
• Tested Species Reactivity: Human
• Gene Symbol: ZFYVE27
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-ZFYVE27 Antibody Titration: 2.5ug/ml
  Positive Control: Jurkat cell lysate