ZDHHC13 Antibody - N-terminal region (ARP44398_T100)

• Product Number: ARP44398_T100
• Name: ZDHHC13 Antibody - N-terminal region (ARP44398_T100)
• Protein Size (# AA): 492 amino acids
• Molecular Weight: 54kDa
• NCBI Gene Id: 54503
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger, DHHC-type containing 13
• Alias Symbols: HIP14L, HIP3RP
• Peptide Sequence: Synthetic peptide located within the following region: MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Matsuda,A., (2003) Oncogene 22 (21), 3307-3318
• Description of Target: ZDHHC13 may be involved in the NF-kappa-B signaling pathway.
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZDHHC13 (ARP44398_T100) antibody is Catalog # AAP44398 (Previous Catalog # AAPP25709)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZDHHC13
• Uniprot ID: Q8IUH4-3
• Protein Name: Palmitoyltransferase ZDHHC13
• Protein Accession #: NP_001001483
• Purification: Protein A purified
• Nucleotide Accession #: NM_001001483
• Tested Species Reactivity: Human
• Gene Symbol: ZDHHC13
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 91%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 83%; Zebrafish: 91%
• Image 1: Human Jurkat
  
  WB Suggested Anti-ZDHHC13 Antibody Titration: 1.25ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Human Lung
  
  Human Lung