| Product Number |
ARP44397_P050 |
| Product Page |
www.avivasysbio.com/eg546729-antibody-c-terminal-region-arp44397-p050.html |
| Name |
EG546729 Antibody - C-terminal region (ARP44397_P050) |
| Protein Size (# AA) |
348 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
546729 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Calcium homeostasis modulator 1 |
| Alias Symbols |
EG546729 |
| Peptide Sequence |
Synthetic peptide located within the following region: GITDQGTMNRLLTSWHKCKPPLRLGQEAPLMSNGWAGGEPRPPRKEVATY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Calhm1 (ARP44397_P050) antibody |
| Blocking Peptide |
For anti-Calhm1 (ARP44397_P050) antibody is Catalog # AAP44397 (Previous Catalog # AAPP25708) |
| Uniprot ID |
D3Z291 |
| Protein Name |
MCG55178 EMBL EDL42030.1 |
| Protein Accession # |
NP_001074740 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001081271 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Calhm1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Horse: 85%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 93%; Rat: 100% |
| Image 1 | Mouse Intestine
 | WB Suggested Anti-EG546729 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Intestine |
|
|
