| Product Number |
ARP44329_P050 |
| Product Page |
www.avivasysbio.com/csf1-antibody-n-terminal-region-arp44329-p050.html |
| Name |
CSF1 Antibody - N-terminal region (ARP44329_P050) |
| Protein Size (# AA) |
438 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
1435 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Colony stimulating factor 1 (macrophage) |
| Alias Symbols |
MCSF, CSF-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
West,R.B., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (3), 690-695 |
| Description of Target |
CSF1 is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. CSF1 may be involved in development of the placenta. The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Four transcript variants encoding three different isoforms have been found for this gene. |
| Protein Interactions |
NOTCH2NL; SGTA; FHL3; GAB3; SOCS1; TNF; CSF1R; HLA-B; CSF1; SLA2; UBC; CBL; PIK3R2; SMARCA4; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Genetic Validation |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-CSF1 (ARP44329_P050) antibody |
| Blocking Peptide |
For anti-CSF1 (ARP44329_P050) antibody is Catalog # AAP44329 (Previous Catalog # AAPS14601) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CSF1 |
| Uniprot ID |
Q5VVF3 |
| Protein Name |
Macrophage colony-stimulating factor 1 |
| Protein Accession # |
NP_757349 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_172210 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CSF1 |
| Predicted Species Reactivity |
Human, Rat, Dog, Guinea Pig, Rabbit |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Dog: 85%; Guinea Pig: 85%; Human: 100%; Rabbit: 92%; Rat: 85% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-CSF1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
| Image 2 | Human liver
 | WB Suggested Anti-CSF1 antibody Titration: 1 ug/mL
Sample Type: Human liver |
|
| Image 3 | liver
 | Rabbit Anti-CSF1 Antibody
Catalog Number: ARP44329_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult liver
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy2/3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|
