| Product Number |
ARP44306_P050 |
| Product Page |
www.avivasysbio.com/lrp8-antibody-middle-region-arp44306-p050.html |
| Name |
Lrp8 Antibody - middle region (ARP44306_P050) |
| Protein Size (# AA) |
996 amino acids |
| Molecular Weight |
110kDa |
| NCBI Gene Id |
16975 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Low density lipoprotein receptor-related protein 8, apolipoprotein e receptor |
| Alias Symbols |
Lr, ap, Lr8b, ApoER2, AA921429, AI848122, 4932703M08Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: NRKMLIFSTDFLSHPFGVAVFEDKVFWTDLENEAIFSANRLNGLEIAILA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Lrp8 is the cell surface receptor for Reelin (RELN) and apolipoprotein E (apoE)-containing ligands. LRP8 participates in transmitting the extracellular Reelin signal to intracellular signaling processes, by binding to DAB1 on its cytoplasmic tail. Reelin acts via both the VLDL receptor (VLDLR) and LRP8 to regulate DAB1 tyrosine phosphorylation and microtubule function in neurons. LRP8 has higher affinity for Reelin than VLDLR. LRP8 is thus a key component of the Reelin pathway which governs neuronal layering of the forebrain during embryonic brain development. Lrp8 binds the endoplasmic reticulum resident receptor-associated protein (RAP). Binds dimers of beta 2-glycoprotein I and may be involved in the suppression of platelet aggregation in the vasculature. Lrp8 is highly expressed in the initial segment of the epididymis, where it affects the functional expression of clusterin and phospholipid hydroperoxide glutathione peroxidase (PHGPx), two proteins required for sperm maturation. Lrp8 may also function as an endocytic receptor. |
| Protein Interactions |
Dab1; Mapk8ip1; Mapk8ip2; Snx17; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Lrp8 (ARP44306_P050) antibody |
| Blocking Peptide |
For anti-Lrp8 (ARP44306_P050) antibody is Catalog # AAP44306 (Previous Catalog # AAPP25685) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q924X6 |
| Protein Name |
Low-density lipoprotein receptor-related protein 8 |
| Protein Accession # |
NP_444303 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_053073 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Lrp8 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 92%; Sheep: 93%; Zebrafish: 79% |
| Image 1 | Mouse Liver
 | WB Suggested Anti-Lrp8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Mouse Liver |
|
