website statistics
Product Datasheet: ARP44306_P050 - Lrp8 antibody - middle region (ARP44306_P050) - Aviva Systems Biology
Lrp8 antibody - middle region (ARP44306_P050)
Data Sheet
Product Number ARP44306_P050
Product Page
Product Name Lrp8 antibody - middle region (ARP44306_P050)
Size 100 ul
Gene Symbol Lrp8
Alias Symbols 4932703M08Rik, AA921429, AI848122, Lr8b, apoER2, ApoER2
Protein Size (# AA) 996 amino acids
Molecular Weight 110kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 16975
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Low density lipoprotein receptor-related protein 8, apolipoprotein e receptor
Description This is a rabbit polyclonal antibody against Lrp8. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: NRKMLIFSTDFLSHPFGVAVFEDKVFWTDLENEAIFSANRLNGLEIAILA
Description of Target Lrp8 is the cell surface receptor for Reelin (RELN) and apolipoprotein E (apoE)-containing ligands. LRP8 participates in transmitting the extracellular Reelin signal to intracellular signaling processes, by binding to DAB1 on its cytoplasmic tail. Reelin acts via both the VLDL receptor (VLDLR) and LRP8 to regulate DAB1 tyrosine phosphorylation and microtubule function in neurons. LRP8 has higher affinity for Reelin than VLDLR. LRP8 is thus a key component of the Reelin pathway which governs neuronal layering of the forebrain during embryonic brain development. Lrp8 binds the endoplasmic reticulum resident receptor-associated protein (RAP). Binds dimers of beta 2-glycoprotein I and may be involved in the suppression of platelet aggregation in the vasculature. Lrp8 is highly expressed in the initial segment of the epididymis, where it affects the functional expression of clusterin and phospholipid hydroperoxide glutathione peroxidase (PHGPx), two proteins required for sperm maturation. Lrp8 may also function as an endocytic receptor.
Protein Interactions Dab1; Mapk8ip1; Mapk8ip2; Snx17;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-Lrp8 (ARP44306_P050) antibody is Catalog # AAP44306 (Previous Catalog # AAPP25685)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Complete computational species homology data Anti-Lrp8 (ARP44306_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Lrp8.
Swissprot Id Q924X6
Protein Name Low-density lipoprotein receptor-related protein 8
Protein Accession # NP_444303
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Lrp8.
Nucleotide Accession # NM_053073
Conjugation Options

ARP44306_P050-FITC Conjugated

ARP44306_P050-HRP Conjugated

ARP44306_P050-Biotin Conjugated

Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 92%; Sheep: 93%; Zebrafish: 79%
Image 1
Mouse Liver
WB Suggested Anti-Lrp8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Mouse Liver

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |