Product Number |
ARP44300_T100 |
Product Page |
www.avivasysbio.com/fgg-antibody-middle-region-arp44300-t100.html |
Name |
FGG Antibody - middle region (ARP44300_T100) |
Protein Size (# AA) |
437 amino acids |
Molecular Weight |
46kDa |
NCBI Gene Id |
2266 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Fibrinogen gamma chain |
Alias Symbols |
- |
Peptide Sequence |
Synthetic peptide located within the following region: RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Uitte (2006) J. Thromb. Haemost. 4 (2), 474-476 |
Description of Target |
FGG is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia.The protein encoded by this gene is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia. Alternative splicing results in two transcript variants encoding different isoforms. |
Protein Interactions |
SUMO2; ASB12; ASB7; ASB6; FN1; VKORC1; KHDRBS2; SERPINA5; VTN; ITGB3; ICAM1; FGG; FGB; FGA; F13B; F13A1; ITGAM; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-FGG (ARP44300_T100) antibody |
Blocking Peptide |
For anti-FGG (ARP44300_T100) antibody is Catalog # AAP44300 (Previous Catalog # AAPP25679) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human FGG |
Uniprot ID |
Q53Y18 |
Protein Name |
Fibrinogen gamma chain |
Protein Accession # |
NP_000500 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_000509 |
Tested Species Reactivity |
Human |
Gene Symbol |
FGG |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | Human Liver
| WB Suggested Anti-FGG Antibody Titration: 2.5ug/ml Positive Control: Human Liver |
|
|