HFE Antibody - C-terminal region (ARP44285_P050)

• Product Number: ARP44285_P050
• Name: HFE Antibody - C-terminal region (ARP44285_P050)
• Protein Size (# AA): 246 amino acids
• Molecular Weight: 28kDa
• NCBI Gene Id: 3077
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Hemochromatosis
• Alias Symbols: HH, HFE1, HLA-H, MVCD7, TFQTL2
• Peptide Sequence: Synthetic peptide located within the following region: FEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Gleeson,D., (2006) Am. J. Gastroenterol. 101 (2), 304-310
• Description of Target: HFE is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in its gene.The protein encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene. At least eleven alternatively spliced variants have been described for this gene. Additional variants have been found but their full-length nature has not been determined.
• Protein Interactions: B2M; SYVN1; UBC; TFR2; TFRC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HFE (ARP44285_P050) antibody is Catalog # AAP44285 (Previous Catalog # AAPP25665)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HFE
• Uniprot ID: Q30201-4
• Protein Name: Hereditary hemochromatosis protein
• Protein Accession #: NP_620577
• Purification: Affinity Purified
• Nucleotide Accession #: NM_139008
• Tested Species Reactivity: Human
• Gene Symbol: HFE
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Rat: 100%; Zebrafish: 91%
• Image 1: Human kidney
  
  Human kidney
• Image 2: Human HepG2
  
  WB Suggested Anti-HFE Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate