| Product Number |
ARP44269_T100 |
| Product Page |
www.avivasysbio.com/tyr-antibody-middle-region-arp44269-t100.html |
| Name |
TYR Antibody - middle region (ARP44269_T100) |
| Protein Size (# AA) |
529 amino acids |
| Molecular Weight |
60 kDa |
| NCBI Gene Id |
7299 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Tyrosinase (oculocutaneous albinism IA) |
| Alias Symbols |
ATN, CMM8, OCA1, OCA1A, OCAIA, SHEP3 |
| Peptide Sequence |
Synthetic peptide located within the following region: CLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQSSMHNALHIYM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Bidinost,C., (2006) Invest. Ophthalmol. Vis. Sci. 47 (4), 1486-1490 |
| Description of Target |
TYR is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. It catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6-dihydroxyindole to indole-5,6 quinone. |
| Protein Interactions |
SYVN1; UBC; TYRP1; RB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
|
| Datasheets/Manuals |
Printable datasheet for anti-TYR (ARP44269_T100) antibody |
| Blocking Peptide |
For anti-TYR (ARP44269_T100) antibody is Catalog # AAP44269 (Previous Catalog # AAPP25649) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TYR |
| Uniprot ID |
P14679 |
| Protein Name |
Tyrosinase |
| Protein Accession # |
NP_000363 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_000372 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TYR |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Goat: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 83% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-TYR Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate |
|
| Image 2 |
 | 25 ug of the indicated Mouse whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. |
|
