| Product Number |
ARP44268_T100 |
| Product Page |
www.avivasysbio.com/tgfbi-antibody-c-terminal-region-arp44268-t100.html |
| Name |
TGFBI Antibody - C-terminal region (ARP44268_T100) |
| Protein Size (# AA) |
416 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
7045 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Transforming growth factor, beta-induced, 68kDa |
| Alias Symbols |
CSD, CDB1, CDG2, CSD1, CSD2, CSD3, EBMD, LCD1, BIGH3, CDGG1 |
| Peptide Sequence |
Synthetic peptide located within the following region: LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
TGFBI Binds to type I, II, and IV collagens. This adhesion protein may play an important role in cell-collagen interactions. In cartilage, may be involved in endochondral bone formation. |
| Protein Interactions |
FAM9B; FN1; COL1A2; COL1A1; COL2A1; COL4A4; COL4A1; COL4A2; COL4A3; A2M; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TGFBI (ARP44268_T100) antibody |
| Other Applications Image 1 Data |
Application: Immunofluorescence:
Sample: Human Corneal tissue (epithelium and stroma)
Primary dilution: 1 to 400
Secondary used: Fluorescein isothiocyanate-conjugated anti-rabbit IgG
Secondary dilution: 1 to 350
Submitted by: Laboratory of the Biology and Pathology of the Eye, Charles University in Prague, Czech Rep. |
| Blocking Peptide |
For anti-TGFBI (ARP44268_T100) antibody is Catalog # AAP44268 (Previous Catalog # AAPP25648) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human TGFBI |
| Uniprot ID |
Q15582 |
| Protein Name |
Transforming growth factor-beta-induced protein ig-h3 |
| Protein Accession # |
AAH26352 |
| Purification |
Protein A purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TGFBI |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IF, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-TGFBI Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate |
|
| Image 2 | Human cornea
 | Species, Tissue/Cell Type:
Human Cornea tissue (epithelium and stroma)
Primary used and dilution: 1:400 |
|
| Image 3 | Jurkat
 | Host: Rabbit
Target Name: TGFBI
Sample Type: Jurkat
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 2.5ug/mL
Peptide Concentration: 2.0ug/mL
Lysate Quantity: 25ug/lane
Gel Concentration: 12% |
|
