Product Number |
ARP44264_P050 |
Product Page |
www.avivasysbio.com/srd5a2-antibody-n-terminal-region-arp44264-p050.html |
Name |
SRD5A2 Antibody - N-terminal region (ARP44264_P050) |
Protein Size (# AA) |
254 amino acids |
Molecular Weight |
28kDa |
NCBI Gene Id |
6716 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) |
Alias Symbols |
MGC138457 |
Peptide Sequence |
Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SRD5A2 (ARP44264_P050) antibody |
Blocking Peptide |
For anti-SRD5A2 (ARP44264_P050) antibody is Catalog # AAP44264 (Previous Catalog # AAPP25644) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SRD5A2 |
Uniprot ID |
Q28892 |
Protein Name |
3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
Protein Accession # |
NP_000339 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000348 |
Tested Species Reactivity |
Human, Monkey |
Gene Symbol |
SRD5A2 |
Predicted Species Reactivity |
Human, Pig, Rabbit, Monkey |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Pig: 86%; Rabbit: 91% |
Image 1 | Monkey adrenal gland
| Sample Type: Monkey adrenal gland Primary Antibody Dilution: 1:25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:1000 Color/Signal Descriptions: Brown: SRD5A2 Blue: Nucleus Gene Name: SRD5A2 Submitted by: Jonathan Bertin, Endoceutics Inc. |
|
Image 2 | Monkey vagina
| Sample Type: Monkey vagina Primary Antibody Dilution: 1:25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:1000 Color/Signal Descriptions: Brown: SRD5A2 Blue: Nucleus Gene Name: SRD5A2 Submitted by: Jonathan Bertin, Endoceutics Inc. |
|
Image 3 | Human THP-1
| WB Suggested Anti-SRD5A2 Antibody Titration: 0.2-1 ug/ml Positive Control: THP-1 cell lysate |
|