MICA antibody - middle region (ARP44247_T100)
Data Sheet
Product Number ARP44247_T100
Product Page www.avivasysbio.com/mica-antibody-middle-region-arp44247-t100.html
Product Name MICA antibody - middle region (ARP44247_T100)
Size 100 ul
Gene Symbol MICA
Alias Symbols DAQB-48K1.7, MGC111087, PERB11.1
Protein Size (# AA) 383 amino acids
Molecular Weight 42kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 4276
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name MHC class I polypeptide-related sequence A
Description This is a rabbit polyclonal antibody against MICA. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: LRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDT
Target Reference Boissel,N., (2006) J. Immunol. 176 (8), 5108-5116
Description of Target MICA is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells.MICA encodes the higly polymorphic MHC (HLA) class I chain-related gene A. The protein product is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-MICA (ARP44247_T100) antibody is Catalog # AAP44247 (Previous Catalog # AAPP25627)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MICA
Complete computational species homology data Anti-MICA (ARP44247_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MICA.
Protein Accession # NP_000238
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MICA.
Nucleotide Accession # NM_000247
Replacement Item This antibody may replace item sc-137242 from Santa Cruz Biotechnology.
Conjugation Options

ARP44247_T100-FITC Conjugated

ARP44247_T100-HRP Conjugated

ARP44247_T100-Biotin Conjugated

CB Replacement sc-137242; sc-20931; sc-23870; sc-271535; sc-376590; sc-43931; sc-5459; sc-5460; sc-5462
Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-MICA Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com