| Product Number |
ARP44247_T100 |
| Product Page |
www.avivasysbio.com/mica-antibody-middle-region-arp44247-t100.html |
| Name |
MICA Antibody - middle region (ARP44247_T100) |
| Protein Size (# AA) |
383 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
4276 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
MHC class I polypeptide-related sequence A |
| Alias Symbols |
PERB11.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: LRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Boissel,N., (2006) J. Immunol. 176 (8), 5108-5116 |
| Description of Target |
MICA is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells.MICA encodes the higly polymorphic MHC (HLA) class I chain-related gene A. The protein product is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MICA (ARP44247_T100) antibody |
| Blocking Peptide |
For anti-MICA (ARP44247_T100) antibody is Catalog # AAP44247 (Previous Catalog # AAPP25627) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MICA |
| Uniprot ID |
Q29983 |
| Protein Accession # |
NP_000238 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_000247 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MICA |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-MICA Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate |
|
|
