| Product Number |
ARP44234_T100 |
| Product Page |
www.avivasysbio.com/gusb-antibody-c-terminal-region-arp44234-t100.html |
| Name |
GUSB Antibody - C-terminal region (ARP44234_T100) |
| Protein Size (# AA) |
651 amino acids |
| Molecular Weight |
72kDa |
| NCBI Gene Id |
2990 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Glucuronidase, beta |
| Description |
|
| Alias Symbols |
BG, MPS7 |
| Peptide Sequence |
Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Urayama,A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (34), 12658-12663 |
| Description of Target |
GUSB plays an important role in the degradation of dermatan and keratan sulfates. |
| Protein Interactions |
GIT2; UBC; FBXO6; PRKACA; GUSB; CES1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GUSB (ARP44234_T100) antibody |
| Blocking Peptide |
For anti-GUSB (ARP44234_T100) antibody is Catalog # AAP44234 (Previous Catalog # AAPP25614) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human GUSB |
| Uniprot ID |
P08236 |
| Protein Name |
Beta-glucuronidase |
| Publications |
Beta-Glucuronidase Catalyzes Deconjugation and Activation of Curcumin-Glucuronide in Bone. J Nat Prod. 82, 500-509 (2019). 30794412
Chemopreventive efficacy of oral curcumin: a prodrug hypothesis. FASEB J. 33, 9453-9465 (2019) 31136203 |
| Protein Accession # |
NP_000172 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_000181 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GUSB |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 92%; Zebrafish: 92% |
| Image 1 | Human Lung
 | Rabbit Anti-GUSB Antibody
Catalog Number: ARP44234
Paraffin Embedded Tissue: Human alveolar cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 2 | Human Lung
 | Human Lung |
|
| Image 3 | Human HepG2
 | WB Suggested Anti-GUSB Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate |
|
