SLC46A3 Antibody - N-terminal region (ARP44158_T100)

• Product Number: ARP44158_T100
• Name: SLC46A3 Antibody - N-terminal region (ARP44158_T100)
• Protein Size (# AA): 461 amino acids
• Molecular Weight: 51kDa
• NCBI Gene Id: 283537
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Solute carrier family 46, member 3
• Alias Symbols: FKSG16
• Peptide Sequence: Synthetic peptide located within the following region: MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISEC
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45
• Description of Target: The function remains unknown.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SLC46A3 (ARP44158_T100) antibody is Catalog # AAP44158 (Previous Catalog # AAPP11934)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC46A3
• Uniprot ID: Q7Z3Q1
• Protein Name: Solute carrier family 46 member 3
• Sample Type Confirmation:

  SLC46A3 is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_861450
• Purification: Protein A purified
• Nucleotide Accession #: NM_181785
• Tested Species Reactivity: Human
• Gene Symbol: SLC46A3
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Dog: 79%; Human: 100%; Mouse: 85%; Rabbit: 79%; Rat: 79%
• Image 1: Human kidney
  
  Human kidney
• Image 2: Human Jurkat
  
  WB Suggested Anti-SLC46A3 Antibody Titration: 2.5ug/ml
  Positive Control: Jurkat cell lysateSLC46A3 is supported by BioGPS gene expression data to be expressed in Jurkat