| Product Number |
ARP44155_T100 |
| Product Page |
www.avivasysbio.com/slc36a3-antibody-n-terminal-region-arp44155-t100.html |
| Name |
SLC36A3 Antibody - N-terminal region (ARP44155_T100) |
| Protein Size (# AA) |
470 amino acids |
| Molecular Weight |
52kDa |
| NCBI Gene Id |
285641 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Solute carrier family 36 (proton/amino acid symporter), member 3 |
| Alias Symbols |
PAT3, TRAMD2, tramdorin2 |
| Peptide Sequence |
Synthetic peptide located within the following region: MSLLGRDYNSELNSLDNGPQSPSESSSSITSENVHPAGEAGLSMMQTLIH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Boll,M., (2003) Genomics 82 (1), 47-56 |
| Description of Target |
The function remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC36A3 (ARP44155_T100) antibody |
| Blocking Peptide |
For anti-SLC36A3 (ARP44155_T100) antibody is Catalog # AAP44155 (Previous Catalog # AAPP11931) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC36A3 |
| Uniprot ID |
Q7Z6B4 |
| Protein Name |
Proton-coupled amino acid transporter 3 |
| Protein Accession # |
NP_861439 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_181774 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC36A3 |
| Predicted Species Reactivity |
Human, Pig |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Pig: 80% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-SLC36A3 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate |
| | Image 2 | Human kidney
 | Human kidney |
|
|
