SLC39A5 Antibody - N-terminal region (ARP44142_P050)

• Product Number: ARP44142_P050
• Name: SLC39A5 Antibody - N-terminal region (ARP44142_P050)
• Protein Size (# AA): 539 amino acids
• Molecular Weight: 56kDa
• NCBI Gene Id: 283375
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Solute carrier family 39 (metal ion transporter), member 5
• Alias Symbols: ZIP5, MYP24, LZT-Hs7
• Peptide Sequence: Synthetic peptide located within the following region: MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Wang,F., (2004) J. Biol. Chem. 279 (49), 51433-51441
• Description of Target: Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A5 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A5 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003).[supplied by OMIM].
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Human Pancreas (formalin-fixed, paraffin-embedded) stained with SLC39A5 antibody ARP44142_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
  IHC Information: Human Pancreas (formalin-fixed, paraffin-embedded) stained with SLC39A5 antibody ARP44142_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
• Blocking Peptide: For anti-SLC39A5 (ARP44142_P050) antibody is Catalog # AAP44142 (Previous Catalog # AAPP25586)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC39A5
• Uniprot ID: Q6ZMH5
• Protein Name: Zinc transporter ZIP5
• Protein Accession #: NP_775867
• Purification: Affinity Purified
• Nucleotide Accession #: NM_173596
• Tested Species Reactivity: Human
• Gene Symbol: SLC39A5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Liver
  
  Human Liver
• Image 2: Human HepG2
  
  WB Suggested Anti-SLC39A5 Antibody Titration: 0.5ug/ml
  Positive Control: HepG2 cell lysate
• Image 3: Human Colon
  
  Rabbit Anti-SLC39A5 antibody
  Catalog Number: ARP44142
  Formalin Fixed Paraffin Embedded Tissue: Human Colon
  Primary antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20x
  Exposure Time: 0.5-2.0sec
• Image 4: Human Prostate
  
  Rabbit Anti-SLC39A5 antibody
  Catalog Number: ARP44142
  Formalin Fixed Paraffin Embedded Tissue: Human Prostate
  Primary antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20x
  Exposure Time: 0.5-2.0sec
• Image 5: Human Uterus
  
  Rabbit Anti-SLC39A5 antibody
  Catalog Number: ARP44142
  Formalin Fixed Paraffin Embedded Tissue: Human Uterus
  Primary antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20x
  Exposure Time: 0.5-2.0sec
• Image 6: Human Jurkat Whole Cell
  
  Host: Rabbit
  Target Name: SLC39A5
  Sample Tissue: Human Jurkat Whole Cell
  Antibody Dilution: 1ug/ml