| Product Number |
ARP44141_P050 |
| Product Page |
www.avivasysbio.com/slc35f3-antibody-c-terminal-region-arp44141-p050.html |
| Name |
Slc35f3 Antibody - C-terminal region (ARP44141_P050) |
| Protein Size (# AA) |
421 amino acids |
| Molecular Weight |
47kDa |
| NCBI Gene Id |
210027 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Solute carrier family 35, member F3 |
| Alias Symbols |
B230375D17Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: IGLGFLLLLLPEEWDVWLIKLLTRLKVRKKEETAESSGDLGTGPQSRSRR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Slc35f3 is a putative solute transporter Potential. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Slc35f3 (ARP44141_P050) antibody |
| Blocking Peptide |
For anti-Slc35f3 (ARP44141_P050) antibody is Catalog # AAP44141 (Previous Catalog # AAPP25585) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q1LZI2 |
| Protein Name |
Solute carrier family 35 member F3 |
| Protein Accession # |
NP_780643 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_175434 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Slc35f3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Mouse Small Intestine
 | WB Suggested Anti-Slc35f3 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Small Intestine |
|
|
