| Product Number |
ARP44139_T100 |
| Product Page |
www.avivasysbio.com/slco6a1-antibody-c-terminal-region-arp44139-t100.html |
| Name |
SLCO6A1 Antibody - C-terminal region (ARP44139_T100) |
| Protein Size (# AA) |
719 amino acids |
| Molecular Weight |
79kDa |
| NCBI Gene Id |
133482 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Solute carrier organic anion transporter family, member 6A1 |
| Alias Symbols |
GST, CT48, OATPY, OATP-I, OATP6A1 |
| Peptide Sequence |
Synthetic peptide located within the following region: LAMTRVVPDKLRSLALGVSYVILRIFGTIPGPSIFKMSGETSCILRDVNK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Suzuki,T., (2003) Mol. Endocrinol. 17 (7), 1203-1215 |
| Description of Target |
The function remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLCO6A1 (ARP44139_T100) antibody |
| Blocking Peptide |
For anti-SLCO6A1 (ARP44139_T100) antibody is Catalog # AAP44139 (Previous Catalog # AAPP25583) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SLCO6A1 |
| Uniprot ID |
Q86UG4 |
| Protein Name |
Solute carrier organic anion transporter family member 6A1 |
| Protein Accession # |
NP_775759 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_173488 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLCO6A1 |
| Predicted Species Reactivity |
Human, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Pig: 79%; Rabbit: 92% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-SLCO6A1 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate |
|
|
