SLCO6A1 Antibody - N-terminal region (ARP44138_T100)

Data Sheet
 
Product Number ARP44138_T100
Product Page www.avivasysbio.com/slco6a1-antibody-n-terminal-region-arp44138-t100.html
Name SLCO6A1 Antibody - N-terminal region (ARP44138_T100)
Protein Size (# AA) 719 amino acids
Molecular Weight 79kDa
NCBI Gene Id 133482
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Solute carrier organic anion transporter family, member 6A1
Alias Symbols GST, CT48, OATPY, OATP-I, OATP6A1
Peptide Sequence Synthetic peptide located within the following region: CCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQKEYQLKTIEKLALEKS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Suzuki,T., (2003) Mol. Endocrinol. 17 (7), 1203-1215
Description of Target The function remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SLCO6A1 (ARP44138_T100) antibody
Blocking Peptide For anti-SLCO6A1 (ARP44138_T100) antibody is Catalog # AAP44138 (Previous Catalog # AAPP25582)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLCO6A1
Uniprot ID Q86UG4
Protein Name Solute carrier organic anion transporter family member 6A1
Protein Accession # NP_775759
Purification Protein A purified
Nucleotide Accession # NM_173488
Tested Species Reactivity Human
Gene Symbol SLCO6A1
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-SLCO6A1 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com