Product Number |
ARP44138_T100 |
Product Page |
www.avivasysbio.com/slco6a1-antibody-n-terminal-region-arp44138-t100.html |
Name |
SLCO6A1 Antibody - N-terminal region (ARP44138_T100) |
Protein Size (# AA) |
719 amino acids |
Molecular Weight |
79kDa |
NCBI Gene Id |
133482 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Solute carrier organic anion transporter family, member 6A1 |
Alias Symbols |
GST, CT48, OATPY, OATP-I, OATP6A1 |
Peptide Sequence |
Synthetic peptide located within the following region: CCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQKEYQLKTIEKLALEKS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Suzuki,T., (2003) Mol. Endocrinol. 17 (7), 1203-1215 |
Description of Target |
The function remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SLCO6A1 (ARP44138_T100) antibody |
Blocking Peptide |
For anti-SLCO6A1 (ARP44138_T100) antibody is Catalog # AAP44138 (Previous Catalog # AAPP25582) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLCO6A1 |
Uniprot ID |
Q86UG4 |
Protein Name |
Solute carrier organic anion transporter family member 6A1 |
Protein Accession # |
NP_775759 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_173488 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLCO6A1 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-SLCO6A1 Antibody Titration: 5.0ug/ml Positive Control: Jurkat cell lysate |
|
|