| Product Number |
ARP44127_P050 |
| Product Page |
www.avivasysbio.com/slc39a12-antibody-n-terminal-region-arp44127-p050.html |
| Name |
SLC39A12 Antibody - N-terminal region (ARP44127_P050) |
| Protein Size (# AA) |
654 amino acids |
| Molecular Weight |
73kDa |
| NCBI Gene Id |
221074 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Solute carrier family 39 (zinc transporter), member 12 |
| Alias Symbols |
ZIP-12, LZT-Hs8, bA570F3.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Taylor,K.M. Biochim. Biophys. Acta 1611 (1-2), 16-30 (2003) |
| Description of Target |
SLC39A12 may act as a zinc-influx transporter and also may be partly involved in the outbreak of schizophrenia. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC39A12 (ARP44127_P050) antibody |
| Blocking Peptide |
For anti-SLC39A12 (ARP44127_P050) antibody is Catalog # AAP44127 (Previous Catalog # AAPP25572) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC39A12 |
| Uniprot ID |
Q504Y0-3 |
| Protein Name |
Zinc transporter ZIP12 |
| Protein Accession # |
NP_689938 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152725 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC39A12 |
| Predicted Species Reactivity |
Human, Cow, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Horse: 85%; Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-SLC39A12 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
|
