Product Number |
ARP44125_T100 |
Product Page |
www.avivasysbio.com/slc25a16-antibody-n-terminal-region-arp44125-t100.html |
Name |
SLC25A16 Antibody - N-terminal region (ARP44125_T100) |
Protein Size (# AA) |
332 amino acids |
Molecular Weight |
36kDa |
NCBI Gene Id |
8034 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16 |
Alias Symbols |
GDA, GDC, ML7, hML7, HGT.1, D10S105E |
Peptide Sequence |
Synthetic peptide located within the following region: KTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMM |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Prohl,C., (2001) Mol. Cell. Biol. 21 (4), 1089-1097 |
Description of Target |
SLC25A16 is a protein that contains three tandemly repeated mitochondrial carrier protein domains. The protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. SLC25A16 gene has a possible role in Graves' disease.This gene encodes a protein that contains three tandemly repeated mitochondrial carrier protein domains. The encoded protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. This gene has a possible role in Graves' disease. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SLC25A16 (ARP44125_T100) antibody |
Blocking Peptide |
For anti-SLC25A16 (ARP44125_T100) antibody is Catalog # AAP44125 (Previous Catalog # AAPP25570) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A16 |
Uniprot ID |
P16260 |
Protein Name |
Graves disease carrier protein |
Protein Accession # |
NP_689920 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_152707 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLC25A16 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 82%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 85% |
Image 1 | Transfected 293T
| WB Suggested Anti-SLC25A16 Antibody Titration: 5.0ug/ml Positive Control: Transfected 293T |
|