Product Number |
ARP44094_T100 |
Product Page |
www.avivasysbio.com/slc25a46-antibody-n-terminal-region-arp44094-t100.html |
Name |
SLC25A46 Antibody - N-terminal region (ARP44094_T100) |
Protein Size (# AA) |
418 amino acids |
Molecular Weight |
46kDa |
NCBI Gene Id |
91137 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Solute carrier family 25, member 46 |
Description |
|
Alias Symbols |
HMSN6B |
Peptide Sequence |
Synthetic peptide located within the following region: RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Nishisho,I., (1991) Science 253 (5020), 665-669 |
Description of Target |
SLC25A46 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane. |
Protein Interactions |
FUNDC1; FHL3; UBC; MARC1; LAMTOR1; ERAL1; SCFD1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SLC25A46 (ARP44094_T100) antibody |
Blocking Peptide |
For anti-SLC25A46 (ARP44094_T100) antibody is Catalog # AAP44094 (Previous Catalog # AAPP25540) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A46 |
Uniprot ID |
Q96AG3 |
Protein Name |
Solute carrier family 25 member 46 |
Publications |
Loss of SLC25A46 causes neurodegeneration by affecting mitochondrial dynamics and energy production in mice. Hum Mol Genet. 26, 3776-3791 (2017). 28934388 |
Sample Type Confirmation |
SLC25A46 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_620128 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_138773 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLC25A46 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Horse, Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-SLC25A46 Antibody Titration: 5.0ug/ml Positive Control: Jurkat cell lysateSLC25A46 is supported by BioGPS gene expression data to be expressed in Jurkat |
|