SLC25A46 Antibody - N-terminal region (ARP44094_T100)

Data Sheet
 
Product Number ARP44094_T100
Product Page www.avivasysbio.com/slc25a46-antibody-n-terminal-region-arp44094-t100.html
Name SLC25A46 Antibody - N-terminal region (ARP44094_T100)
Protein Size (# AA) 418 amino acids
Molecular Weight 46kDa
NCBI Gene Id 91137
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Solute carrier family 25, member 46
Description
Alias Symbols HMSN6B
Peptide Sequence Synthetic peptide located within the following region: RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Nishisho,I., (1991) Science 253 (5020), 665-669
Description of Target SLC25A46 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.
Protein Interactions FUNDC1; FHL3; UBC; MARC1; LAMTOR1; ERAL1; SCFD1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SLC25A46 (ARP44094_T100) antibody
Blocking Peptide For anti-SLC25A46 (ARP44094_T100) antibody is Catalog # AAP44094 (Previous Catalog # AAPP25540)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A46
Uniprot ID Q96AG3
Protein Name Solute carrier family 25 member 46
Publications

Loss of SLC25A46 causes neurodegeneration by affecting mitochondrial dynamics and energy production in mice. Hum Mol Genet. 26, 3776-3791 (2017). 28934388

Sample Type Confirmation

SLC25A46 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_620128
Purification Protein A purified
Nucleotide Accession # NM_138773
Tested Species Reactivity Human
Gene Symbol SLC25A46
Predicted Species Reactivity Human, Mouse, Rat, Cow, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-SLC25A46 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysateSLC25A46 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com