Product Number |
ARP44073_T100 |
Product Page |
www.avivasysbio.com/slc22a16-antibody-n-terminal-region-arp44073-t100.html |
Name |
SLC22A16 Antibody - N-terminal region (ARP44073_T100) |
Protein Size (# AA) |
577 amino acids |
Molecular Weight |
63kDa |
NCBI Gene Id |
85413 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Solute carrier family 22 (organic cation/carnitine transporter), member 16 |
Alias Symbols |
CT2, OAT6, OCT6, OKB1, FLIPT2, HEL-S-18, dJ261K5.1 |
Peptide Sequence |
Synthetic peptide located within the following region: CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Okabe,M., (2005) Biochem. Biophys. Res. Commun. 333 (3), 754-762 |
Description of Target |
Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).[supplied by OMIM]. |
Protein Interactions |
LYN; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SLC22A16 (ARP44073_T100) antibody |
Blocking Peptide |
For anti-SLC22A16 (ARP44073_T100) antibody is Catalog # AAP44073 (Previous Catalog # AAPP25519) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A16 |
Uniprot ID |
Q96RU0 |
Protein Name |
Solute carrier family 22 member 16 |
Publications |
Immunohistochemical expression profiles of solute carrier transporters in alpha-fetoprotein-producing gastric cancer. Histopathology. 69, 812-821 (2016). 27245475 |
Protein Accession # |
NP_149116 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_033125 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLC22A16 |
Predicted Species Reactivity |
Human |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-SLC22A16 Antibody Titration: 2.5ug/ml Positive Control: HepG2 cell lysate |
|
Image 2 | Human kidney
| Human kidney |
|