SLC22A16 Antibody - N-terminal region (ARP44073_T100)

Data Sheet
 
Product Number ARP44073_T100
Product Page www.avivasysbio.com/slc22a16-antibody-n-terminal-region-arp44073-t100.html
Name SLC22A16 Antibody - N-terminal region (ARP44073_T100)
Protein Size (# AA) 577 amino acids
Molecular Weight 63kDa
NCBI Gene Id 85413
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Solute carrier family 22 (organic cation/carnitine transporter), member 16
Alias Symbols CT2, OAT6, OCT6, OKB1, FLIPT2, HEL-S-18, dJ261K5.1
Peptide Sequence Synthetic peptide located within the following region: CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Okabe,M., (2005) Biochem. Biophys. Res. Commun. 333 (3), 754-762
Description of Target Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).[supplied by OMIM].
Protein Interactions LYN;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SLC22A16 (ARP44073_T100) antibody
Blocking Peptide For anti-SLC22A16 (ARP44073_T100) antibody is Catalog # AAP44073 (Previous Catalog # AAPP25519)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A16
Uniprot ID Q96RU0
Protein Name Solute carrier family 22 member 16
Publications

Immunohistochemical expression profiles of solute carrier transporters in alpha-fetoprotein-producing gastric cancer. Histopathology. 69, 812-821 (2016). 27245475

Protein Accession # NP_149116
Purification Protein A purified
Nucleotide Accession # NM_033125
Tested Species Reactivity Human
Gene Symbol SLC22A16
Predicted Species Reactivity Human
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human HepG2
WB Suggested Anti-SLC22A16 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
Image 2
Human kidney
Human kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com