SLC9A7 Antibody - N-terminal region (ARP44066_P050)

• Product Number: ARP44066_P050
• Name: SLC9A7 Antibody - N-terminal region (ARP44066_P050)
• Protein Size (# AA): 725 amino acids
• Molecular Weight: 80kDa
• NCBI Gene Id: 84679
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7
• Alias Symbols: NHE7, NHE-7, MRX108, SLC9A6
• Peptide Sequence: Synthetic peptide located within the following region: LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lin,P.J., J. Cell. Sci. 118 (PT 9), 1885-1897 (2005)
• Description of Target: Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. It may play an important role in maintaining cation homeostasis and function of the trans-Golgi network.Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. This gene is expressed predominantly in the trans-Golgi network, and mediates the influx of sodium or potassium in exchange for hydrogen. It may thus play an important role in maintaining cation homeostasis and function of the trans-Golgi network. This gene is part of a gene cluster on chromosome Xp11.23.Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. This gene is expressed predominantly in the trans-Golgi network, and mediates the influx of sodium or potassium in exchange for hydrogen. It may thus play an important role in maintaining cation homeostasis and function of the trans-Golgi network. This gene is part of a gene cluster on chromosome Xp11.23.
• Protein Interactions: UBC; SCAMP5; SCAMP2; SCAMP1; SLC9A7;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SLC9A7 (ARP44066_P050) antibody is Catalog # AAP44066 (Previous Catalog # AAPP25512)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC9A7
• Uniprot ID: Q96T83
• Protein Name: Sodium/hydrogen exchanger 7
• Protein Accession #: NP_115980
• Purification: Affinity Purified
• Nucleotide Accession #: NM_032591
• Tested Species Reactivity: Human
• Gene Symbol: SLC9A7
• Predicted Species Reactivity: Human, Mouse, Dog, Goat, Guinea Pig, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Goat: 85%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-SLC9A7 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:12500
  Positive Control: Jurkat cell lysate